Recombinant Human MPZL2 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens myelin protein zero like 2 (MPZL2), transcript variant 2 (NM_144765).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID O60487
Entry Name MPZL2_HUMAN
Gene Names MPZL2 EVA EVA1 UNQ606/PRO1192
Alternative Gene Names EVA EVA1
Alternative Protein Names Myelin protein zero-like protein 2 (Epithelial V-like antigen 1)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 215
Molecular Weight(Da) 24484
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MYGKSSTRAVLLLLGIQLTALWPIAAVEIYTSRVLEAVNGTDARLKCTFSSFAPVGDALTVTWNFRPLDGGPEQFVFYYHIDPFQPMSGRFKDRVSWDGNPERYDASILLWKLQFDDNGTYTCQVKNPPDVDGVIGEIRLSVVHTVRFSEIHFLALAIGSACALMIIIVIVVVLFQHYRKKRWAERAHKVVEIKSKEEERLNQEKKVSVYLEDTD
Background
Function FUNCTION: Mediates homophilic cell-cell adhesion.
Pathway
Protein Families Myelin P0 protein family
Tissue Specificity Widely expressed. In fetal tissues, highest expression in the inner ear. In adult tissues, highest levels in thymus and lung. {ECO:0000269|PubMed:29961571}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE615996

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human MPZL2 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.